PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013591017.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 294aa    MW: 33381.9 Da    PI: 8.4899
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013591017.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.85.2e-182471148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg W++eEde+l+++++ +G ++W+++++  g+ R++k+c++rw +yl
   XP_013591017.1 24 RGLWSPEEDEKLLRYITTHGHPSWSSVPKLAGLERCGKSCRLRWINYL 71
                     788*******************************************97 PP

2Myb_DNA-binding55.41.4e-1777120146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg++T+eE++ ++d+++ lG++ W+ Ia++++ gRt++++k++w++
   XP_013591017.1  77 RGSFTAEEEQTIIDVHRILGNK-WAQIAKHLP-GRTDNEVKNFWNS 120
                      89********************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.7E-251674IPR009057Homeodomain-like
PROSITE profilePS5129417.0021971IPR017930Myb domain
SuperFamilySSF466893.48E-2922118IPR009057Homeodomain-like
SMARTSM007174.9E-132373IPR001005SANT/Myb domain
PfamPF002491.9E-152471IPR001005SANT/Myb domain
CDDcd001675.25E-112771No hitNo description
PROSITE profilePS5129426.60372126IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.8E-2675126IPR009057Homeodomain-like
SMARTSM007176.5E-1676124IPR001005SANT/Myb domain
PfamPF002495.1E-1677120IPR001005SANT/Myb domain
CDDcd001677.43E-1279119No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 294 aa     Download sequence    Send to blast
MRGKWEMKRD EMGHRCCGKH KVNRGLWSPE EDEKLLRYIT THGHPSWSSV PKLAGLERCG  60
KSCRLRWINY LRPDLKRGSF TAEEEQTIID VHRILGNKWA QIAKHLPGRT DNEVKNFWNS  120
CIKKKLLSQG LDPSTHNLMP SHKRSATSSN NNIPKPSKMK SIMTNPTFDL STTAFSITNL  180
NPHTSTKPNK VKSPIRTPLP SQTIIPINNT MSSLLDYENM IPSWSDVDGV APIHEEAPMF  240
SSEKAVVGVD DDYFNMDILF NTPSTTTFDH DFASIFSSAM SIDFNPMDDL GWTF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-30241267108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1893350.0AC189335.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB039A19, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009124668.10.0PREDICTED: transcription factor MYB86-like
RefseqXP_013591017.10.0PREDICTED: transcription factor MYB86-like
TrEMBLA0A078I1B70.0A0A078I1B7_BRANA; BnaA01g30350D protein
TrEMBLA0A0D3AE630.0A0A0D3AE63_BRAOL; Uncharacterized protein
TrEMBLM4FE180.0M4FE18_BRARP; Uncharacterized protein
STRINGBra039339.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM79552539
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G12720.11e-174myb domain protein 67